TNFSF4 Antibody - middle region : HRP

TNFSF4 Antibody - middle region : HRP
Artikelnummer
AVIARP59092_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF4/OX4. It is found to be involved in T cell antigen-presenting cell (APC) interactions. In surface Ig- and CD40-stimulated B cells, this cytokine along with CD70 has been shown to provide CD28-independent costimulatory signals to T cells. This protein and its receptor are reported to directly mediate adhesion of activated T cells to vascular endothelial cells.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TNFSF4

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: QEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tumor necrosis factor ligand superfamily member 4

Protein Size: 183

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP59092_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP59092_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 7292
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×