TNKS1BP1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: TNKS-1 mRNA in urine sediment from patients with bladder TCC correlated with tumor stage, and higher preoperative levels were associated with increased risk of early recurrence. Tankyrase-1 is required in the assembly of bipolar spindles and the spindle-pole protein NuMA as a substrate for covalent modification by tankyrase-1. Data also show that tankyrase 1 inhibition in human cancer cells enhances telomere shortening by a telomerase inhibitor and hastens cell death.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TNKS1BP1

Key Reference: Gelmini,S., (2007) Clin. Chem. Lab. Med. 45 (7), 862-866

Molecular Weight: 190kDa

Peptide Sequence: Synthetic peptide located within the following region: DGEASQTEDVDGTWGSSAARWSDQGPAQTSRRPSQGPPARSPSQDFSFIE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 182 kDa tankyrase-1-binding protein

Protein Size: 1729

Purification: Affinity Purified

• Artikelnummer: AVIARP58347_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58347_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 85456
• Wirt: Rabbit
• Konjugat: Conjugated, HRP