TNPO2 Antibody - N-terminal region : Biotin

TNPO2 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP54955_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Transportin-2 (TNPO2) mediates nuclear import of HuR protein in vitro. It also participates in mRNA export from the nucleus.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TNPO2

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 100kDa

Peptide Sequence: Synthetic peptide located within the following region: MDWQPDEQGLQQVLQLLKDSQSPNTATQRIVQDKLKQLNQFPDFNNYLIF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transportin-2

Protein Size: 887

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54955_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54955_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 30000
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×