English
TP53INP2 Antibody - C-terminal region : HRP
TP53INP2 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP58965_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: The function of TP53INP2 remains unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TP53INP2
Molecular Weight: 24kDa
Peptide Sequence: Synthetic peptide located within the following region: RLQRARQRAERHALSAKAVQRQNRARESRPRRSKNQSSFIYQPCQRQFNY
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Tumor protein p53-inducible nuclear protein 2
Protein Size: 220
Purification: Affinity Purified
Description of Target: The function of TP53INP2 remains unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TP53INP2
Molecular Weight: 24kDa
Peptide Sequence: Synthetic peptide located within the following region: RLQRARQRAERHALSAKAVQRQNRARESRPRRSKNQSSFIYQPCQRQFNY
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Tumor protein p53-inducible nuclear protein 2
Protein Size: 220
Purification: Affinity Purified
| Artikelnummer | AVIARP58965_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58965_P050-HRP |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 58476 |
| Wirt | Rabbit |
| Konjugat | Conjugated, HRP |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
