TPD52L3 Antibody - middle region : Biotin

TPD52L3 Antibody - middle region : Biotin
Artikelnummer
AVIARP58727_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The exact functions of TPD52L3 remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TPD52L3

Key Reference: Cao,Q., (2006) Biochem. Biophys. Res. Commun. 344 (3), 798-806

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: GLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tumor protein D55

Protein Size: 136

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58727_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58727_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rabbit, Dog (Canine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 89882
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×