TPD52L3 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact functions of TPD52L3 remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TPD52L3

Key Reference: Cao,Q., (2006) Biochem. Biophys. Res. Commun. 344 (3), 798-806

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: GLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tumor protein D55

Protein Size: 136

Purification: Affinity Purified

• Artikelnummer: AVIARP58727_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58727_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rabbit, Dog (Canine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 89882
• Wirt: Rabbit
• Konjugat: Conjugated, HRP