TRAK1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRAK1

Molecular Weight: 106kDa

Peptide Sequence: Synthetic peptide located within the following region: IYGYDHDDWLHTPLISPDANIDLTTEQIEETLKYFLLCAERVGQMTKTYN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Trafficking kinesin-binding protein 1

Protein Size: 953

Purification: Affinity Purified

• Artikelnummer: AVIARP54520_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54520_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 22906
• Wirt: Rabbit