TRAPPC2L Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: TRAPPC2L may play a role in vesicular transport from endoplasmic reticulum to Golgi.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRAPPC2L

Key Reference: Rual,J.F., (2005) Nature 437 (7062), 1173-1178

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKAL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Trafficking protein particle complex subunit 2-like protein

Protein Size: 140

Purification: Affinity Purified

Subunit: 2-like protein

• Artikelnummer: AVIARP56852_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56852_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 51693
• Wirt: Rabbit