TRAPPC4 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TRAPPC4 may play a role in vesicular transport from endoplasmic reticulum to Golgi.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRAPPC4

Key Reference: Gavin,A.C., (2002) Nature 415 (6868), 141-147

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: EKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETDTFKLHCYQTLTGIKFV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Trafficking protein particle complex subunit 4

Protein Size: 219

Purification: Affinity Purified

Subunit: 4

• Artikelnummer: AVIARP56842_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56842_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 51399
• Wirt: Rabbit