TRAPPC4 Antibody - middle region : HRP

TRAPPC4 Antibody - middle region : HRP
Artikelnummer
AVIARP56842_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TRAPPC4 may play a role in vesicular transport from endoplasmic reticulum to Golgi.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRAPPC4

Key Reference: Gavin,A.C., (2002) Nature 415 (6868), 141-147

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: EKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETDTFKLHCYQTLTGIKFV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Trafficking protein particle complex subunit 4

Protein Size: 219

Purification: Affinity Purified

Subunit: 4
Mehr Informationen
Artikelnummer AVIARP56842_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56842_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51399
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×