TRPC3 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: TRPC3 is thought to form a receptor-activated non-selective calcium permeant cation channel. Probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. TRPC3 is activated by diacylglycerol (DAG) in a membrane-delimited fashion, independently of protein kinase C, and by inositol-1,4,5-triphosphate receptors (ITPR) with bound IP3. TRPC3 may also be activated by internal calcium store depletion.

Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of human TRPC3

Key Reference: Lof,C., (2008) J. Cell. Physiol. 216 (1), 245-252

Molecular Weight: 97kDa

Peptide Sequence: Synthetic peptide located within the following region: MEGSPSLRRMTVMREKGRRQAVRGPAFMFNDRGTSLTAEEERFLDAAEYG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Short transient receptor potential channel 3

Protein Size: 848

Purification: Affinity Purified

• Artikelnummer: AVIARP58715_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58715_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 7222
• Wirt: Rabbit