TSPYL4 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: TSPYL4 belongs to the nucleosome assembly protein (NAP) family. The functions of TSPYL4 remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TSPYL4

Key Reference: Mungall,A.J., (2003) Nature 425 (6960), 805-811

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: QKEKKVAGGVKEETRPRAPKINNCMDSLEAIDQELSNVNAQADRAFLQLE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Testis-specific Y-encoded-like protein 4

Protein Size: 414

Purification: Affinity Purified

• Artikelnummer: AVIARP55378_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55378_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 23270
• Wirt: Rabbit