TSPYL4 Antibody - middle region : HRP

TSPYL4 Antibody - middle region : HRP
Artikelnummer
AVIARP55378_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TSPYL4 belongs to the nucleosome assembly protein (NAP) family. The functions of TSPYL4 remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TSPYL4

Key Reference: Mungall,A.J., (2003) Nature 425 (6960), 805-811

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: QKEKKVAGGVKEETRPRAPKINNCMDSLEAIDQELSNVNAQADRAFLQLE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Testis-specific Y-encoded-like protein 4

Protein Size: 414

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55378_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55378_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23270
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×