English
TUB Antibody - N-terminal region : Biotin
TUB Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57909_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: TUB functions in signal transduction from heterotrimeric G protein-coupled receptors. It could be involved in the hypothalamic regulation of body weight.This gene encodes a member of the Tubby family of bipartite transcription factors. The encoded protein may play a role in obesity and sensorineural degradation. The crystal structure has been determined for a similar protein in mouse, and it functions as a membrane-bound transcription regulator that translocates to the nucleus in response to phosphoinositide hydrolysis. Two transcript variants encoding distinct isoforms have been identified for this gene.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TUB
Key Reference: Snieder,H., (2008) Diabetologia 51 (1), 54-61
Molecular Weight: 62kDa
Peptide Sequence: Synthetic peptide located within the following region: MGARTPLPSFWVSFFAETGILFPGGTPWPMGSQHSKQHRKPGPLKRGHRR
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Tubby protein homolog
Protein Size: 561
Purification: Affinity Purified
Description of Target: TUB functions in signal transduction from heterotrimeric G protein-coupled receptors. It could be involved in the hypothalamic regulation of body weight.This gene encodes a member of the Tubby family of bipartite transcription factors. The encoded protein may play a role in obesity and sensorineural degradation. The crystal structure has been determined for a similar protein in mouse, and it functions as a membrane-bound transcription regulator that translocates to the nucleus in response to phosphoinositide hydrolysis. Two transcript variants encoding distinct isoforms have been identified for this gene.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TUB
Key Reference: Snieder,H., (2008) Diabetologia 51 (1), 54-61
Molecular Weight: 62kDa
Peptide Sequence: Synthetic peptide located within the following region: MGARTPLPSFWVSFFAETGILFPGGTPWPMGSQHSKQHRKPGPLKRGHRR
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Tubby protein homolog
Protein Size: 561
Purification: Affinity Purified
| Artikelnummer | AVIARP57909_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP57909_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Rabbit, Dog (Canine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting, Immunohistochemistry |
| Human Gene ID | 7275 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
