Tubb2a Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Tubb2a

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: RKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tubulin beta-2A chain

Protein Size: 445

Purification: Affinity Purified

• Artikelnummer: AVIARP58545_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58545_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 22151
• Wirt: Rabbit