TUFM Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: TUFM is a protein which participates in protein translation in mitochondria. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency resulting in lactic acidosis and fatal encephalopathy. This gene encodes a protein which participates in protein translation in mitochondria. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency resulting in lactic acidosis and fatal encephalopathy. A pseudogene has been identified on chromosome 17. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TUFM

Key Reference: Valente,L., (2007) Am. J. Hum. Genet. 80 (1), 44-58

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: PEKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTLAM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Elongation factor Tu, mitochondrial

Protein Size: 455

Purification: Affinity Purified

• Artikelnummer: AVIARP58546_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58546_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 7284
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin