Twf1 Antibody - C-terminal region : Biotin

Twf1 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP56488_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Twf1 is an actin-binding protein involved in motile and morphological processes. It inhibits actin polymerization, likely by sequestering G-actin. By capping the barbed ends of filaments, it also regulates motility. It seems to play an important role in clathrin-mediated endocytosis and distribution of endocytic organelles.

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: EKLSKRQLNYVQLEIDIKNETIILANTENTELKDLPKRIPKDSARYHFFL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Twinfilin-1

Protein Size: 350

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56488_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56488_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 315265
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×