Twf1 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Twf1 is an actin-binding protein involved in motile and morphological processes. It inhibits actin polymerization, likely by sequestering G-actin. By capping the barbed ends of filaments, it also regulates motility. It seems to play an important role in clathrin-mediated endocytosis and distribution of endocytic organelles.

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: EKLSKRQLNYVQLEIDIKNETIILANTENTELKDLPKRIPKDSARYHFFL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Twinfilin-1

Protein Size: 350

Purification: Affinity Purified

• Artikelnummer: AVIARP56488_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56488_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 315265
• Wirt: Rabbit