TXNDC4 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TXNDC4 mediates thiol-dependent retention in the early secretory pathway, forming mixed disulfides with substrate proteins through its conserved CRFS motif. TXNDC4 inhibits the calcium channel activity of ITPR1. TXNDC4 may have a role in the control of oxidative protein folding in the endoplasmic reticulum. TXNDC4 is required to retain ERO1L and ERO1LB in the endoplasmic reticulum.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TXNDC4

Key Reference: Mariappan,M., (2008) J. Biol. Chem. 283 (10), 6375-6383

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: LHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Endoplasmic reticulum resident protein 44

Protein Size: 406

Purification: Affinity Purified

• Artikelnummer: AVIARP58726_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58726_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 23071
• Wirt: Rabbit
• Konjugat: Conjugated, FITC