English
TXNDC5 Antibody - N-terminal region : Biotin
TXNDC5 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58547_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: TXNDC5 is a protein-disulfide isomerase. Its expression is induced by hypoxia and its role may be to protect hypoxic cells from apoptosis.This gene encodes a protein-disulfide isomerase. Its expression is induced by hypoxia and its role may be to protect hypoxic cells from apoptosis. This gene can be co-transcribed with the upstream gene MU.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TXNDC5
Key Reference: Wang,Y., (2007) Exp. Biol. Med. (Maywood) 232 (9), 1152-1159
Molecular Weight: 48kDa
Peptide Sequence: Synthetic peptide located within the following region: ARAQEAAAAAADGPPAADGEDGQDPHSKHLYTADMFTHGIQSAAHFVMFF
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Thioredoxin domain-containing protein 5
Protein Size: 432
Purification: Affinity Purified
Description of Target: TXNDC5 is a protein-disulfide isomerase. Its expression is induced by hypoxia and its role may be to protect hypoxic cells from apoptosis.This gene encodes a protein-disulfide isomerase. Its expression is induced by hypoxia and its role may be to protect hypoxic cells from apoptosis. This gene can be co-transcribed with the upstream gene MU.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TXNDC5
Key Reference: Wang,Y., (2007) Exp. Biol. Med. (Maywood) 232 (9), 1152-1159
Molecular Weight: 48kDa
Peptide Sequence: Synthetic peptide located within the following region: ARAQEAAAAAADGPPAADGEDGQDPHSKHLYTADMFTHGIQSAAHFVMFF
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Thioredoxin domain-containing protein 5
Protein Size: 432
Purification: Affinity Purified
| Artikelnummer | AVIARP58547_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58547_P050-Biotin |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 81567 |
| Wirt | Rabbit |
| Konjugat | Conjugated, Biotin |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
