TXNDC5 Antibody - N-terminal region : HRP

TXNDC5 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP58547_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TXNDC5 is a protein-disulfide isomerase. Its expression is induced by hypoxia and its role may be to protect hypoxic cells from apoptosis.This gene encodes a protein-disulfide isomerase. Its expression is induced by hypoxia and its role may be to protect hypoxic cells from apoptosis. This gene can be co-transcribed with the upstream gene MU.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TXNDC5

Key Reference: Wang,Y., (2007) Exp. Biol. Med. (Maywood) 232 (9), 1152-1159

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: ARAQEAAAAAADGPPAADGEDGQDPHSKHLYTADMFTHGIQSAAHFVMFF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Thioredoxin domain-containing protein 5

Protein Size: 432

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58547_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58547_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 81567
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×