TXNIP Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: TXNIP may act as an oxidative stress mediator by inhibiting thioredoxin activity or by limiting its bioavailability. It interacts with COPS5 and restores COPS5-induced suppression of CDKN1B stability, blocking the COPS5-mediated translocation of CDKN1B from the nucleus to the cytoplasm. It functions as a transcriptional repressor, possibly by acting as a bridge molecule between transcription factors and corepressor complexes, and over-expression will induce G0/G1 cell cycle arrest. It is required for the maturation of natural killer cells.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TXNIP

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: QTSEYLRYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Thioredoxin-interacting protein

Protein Size: 391

Purification: Affinity Purified

• Artikelnummer: AVIARP59055_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59055_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 10628
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin