TXNIP Antibody - N-terminal region : FITC

TXNIP Antibody - N-terminal region : FITC
Artikelnummer
AVIARP59055_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TXNIP may act as an oxidative stress mediator by inhibiting thioredoxin activity or by limiting its bioavailability. It interacts with COPS5 and restores COPS5-induced suppression of CDKN1B stability, blocking the COPS5-mediated translocation of CDKN1B from the nucleus to the cytoplasm. It functions as a transcriptional repressor, possibly by acting as a bridge molecule between transcription factors and corepressor complexes, and over-expression will induce G0/G1 cell cycle arrest. It is required for the maturation of natural killer cells.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TXNIP

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: QTSEYLRYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Thioredoxin-interacting protein

Protein Size: 391

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP59055_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP59055_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 10628
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×