TYMSOS Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C18orf56

Molecular Weight: 13kDa

Peptide Sequence: Synthetic peptide located within the following region: MTPASGATASLGRLRARPRSRWDAAYLPAVAAVCVARASHVPNGTLRFGV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TYMS opposite strand protein

Protein Size: 123

Purification: Affinity Purified

• Artikelnummer: AVIARP56201_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56201_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 494514
• Wirt: Rabbit