English
UCHL1 Antibody - C-terminal region : HRP
UCHL1 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP58968_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: The protein encoded by this gene belongs to the peptidase C12 family. This enzyme is a thiol protease that hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin. This gene is specifically expressed in the neurons and in cells of the diffuse neuroendocrine system. Mutations in this gene may be associated with Parkinson disease.
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human UCHL1
Molecular Weight: 25kDa
Peptide Sequence: Synthetic peptide located within the following region: HLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVALC
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Ubiquitin carboxyl-terminal hydrolase isozyme L1
Protein Size: 223
Purification: Affinity Purified
Description of Target: The protein encoded by this gene belongs to the peptidase C12 family. This enzyme is a thiol protease that hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin. This gene is specifically expressed in the neurons and in cells of the diffuse neuroendocrine system. Mutations in this gene may be associated with Parkinson disease.
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human UCHL1
Molecular Weight: 25kDa
Peptide Sequence: Synthetic peptide located within the following region: HLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVALC
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Ubiquitin carboxyl-terminal hydrolase isozyme L1
Protein Size: 223
Purification: Affinity Purified
| Artikelnummer | AVIARP58968_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58968_P050-HRP |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting, Immunohistochemistry |
| Human Gene ID | 7345 |
| Wirt | Rabbit |
| Konjugat | Conjugated, HRP |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
