ULK3 Antibody - middle region : Biotin

ULK3 Antibody - middle region : Biotin
Artikelnummer
AVIARP58971_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: ULK3 is the serine/threonine protein kinase which enhances GLI1 and GLI2 transcriptional activity and consequently positively regulates GLI-dependent SHH signaling. ULK3 may exert this function by promoting GLI1 nuclear localization. ULK3 phosphorylates in vitro GLI2, as well as GLI1 and GLI3, although less efficiently.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ULK3

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: LGRATALVVQAVKKDQEGDSAAALSLYCKALDFFVPALHYEVDAQRKEAI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein kinase ULK3

Protein Size: 472

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58971_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58971_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 25989
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×