ULK3 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: ULK3 is the serine/threonine protein kinase which enhances GLI1 and GLI2 transcriptional activity and consequently positively regulates GLI-dependent SHH signaling. ULK3 may exert this function by promoting GLI1 nuclear localization. ULK3 phosphorylates in vitro GLI2, as well as GLI1 and GLI3, although less efficiently.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ULK3

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: LGRATALVVQAVKKDQEGDSAAALSLYCKALDFFVPALHYEVDAQRKEAI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Serine/threonine-protein kinase ULK3

Protein Size: 472

Purification: Affinity Purified

• Artikelnummer: AVIARP58971_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58971_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 25989
• Wirt: Rabbit
• Konjugat: Conjugated, HRP