UNC45A Antibody - middle region : HRP

UNC45A Antibody - middle region : HRP
Artikelnummer
AVIARP56262_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: UNC45A plays a role in cell proliferation and myoblast fusion, binds progesterone receptor (PGR; MIM 607311) and HSP90 (HSPCA; MIM 140571), and acts as a regulator of the progesterone receptor chaperoning pathway.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human UNC45A

Key Reference: Chadli,A., (2008) J. Biol. Chem. 283 (15), 9509-9512

Molecular Weight: 102kDa

Peptide Sequence: Synthetic peptide located within the following region: REIASTLMESEMMEILSVLAKGDHSPVTRAAAACLDKAVEYGLIQPNQDG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein unc-45 homolog A

Protein Size: 929

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56262_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56262_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 55898
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×