UQCRFS1 Antibody - N-terminal region : FITC

UQCRFS1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58549_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: UQCRFS1 is the component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human UQCRFS1

Key Reference: Xu,H., (2007) Acta Biochim. Biophys. Sin. (Shanghai) 39 (12), 964-973

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytochrome b-c1 complex subunit Rieske, mitochondrial

Protein Size: 274

Purification: Affinity Purified

Subunit: Rieske, mitochondrial
Mehr Informationen
Artikelnummer AVIARP58549_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58549_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 7386
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×