USP7 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: USP7 is a hydrolase that deubiquitinates target proteins such as FOXO4, TP53, MDM2, PTEN and DAXX. Together with DAXX, USP7 prevents MDM2 self-ubiquitination and enhances the E3 ligase activity of MDM2 towards TP53, thereby promoting TP53 ubiquitination and proteasomal degradation. USP7 deubiquitinates TP53 and MDM2 and strongly stabilizes TP53 even in the presence of excess MDM2, and also induces TP53-dependent cell growth repression and apoptosis. Deubiquitination of FOXO4 in presence of hydrogen peroxide is not dependent on TP53 and inhibits FOXO4-induced transcriptional activity. In association with DAXX, USP7 is involved in the deubiquitination and translocation of PTEN from the nucleus to the cytoplasm, both processes that are counteracted by PML. USP7 is involved in cell proliferation during early embryonic development. USP7 contributes to the overall stabilization and trans-activation capability of the herpesvirus 1 trans-acting transcriptional protein ICP0/VMW110 during HSV-1 infection.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human USP7

Molecular Weight: 128kDa

Peptide Sequence: Synthetic peptide located within the following region: RVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ubiquitin carboxyl-terminal hydrolase 7

Protein Size: 1102

Purification: Affinity Purified

• Artikelnummer: AVIARP59057_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59057_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 7874
• Wirt: Rabbit
• Konjugat: Conjugated, HRP