VASH1 Antibody - N-terminal region : Biotin

VASH1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55099_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: VASH1 is the angiogenesis inhibitor. It inhibits migration, proliferation and network formation by endothelial cells as well as angiogenesis. This inhibitory effect is selective to endothelial cells as it does not affect the migration of smooth muscle cells or fibroblasts. VASH1 does not affect the proliferation of cancer cells in vitro, but inhibits tumor growth and tumor angiogenesis. It acts in an autocrine manner. VASH1 inhibits artery neointimal formation and macrophage infiltration. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human VASH1

Key Reference: Yoshinaga,K., (2008) Cancer Sci. 99 (5), 914-919

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: ATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPER

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Vasohibin-1

Protein Size: 365

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55099_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55099_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 22846
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×