VEGFB Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Vascular endothelial growth factor B (VEGFB) signals via the endothelial receptor VEGFR1 (MIM 165070) and is a regulator of blood vessel physiology, with a role in endothelial targeting of lipids to peripheral tissues (summarized by Hagberg et al., 2010 [PubMed 20228789]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human VEGFB

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: PTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKKDSAVKPDRAAT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Vascular endothelial growth factor B

Protein Size: 207

Purification: Affinity Purified

• Artikelnummer: AVIARP58975_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58975_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 7423
• Wirt: Rabbit
• Konjugat: Conjugated, HRP