VGLL3 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: VGLL3 belongs to the vestigial family. It may act as a specific coactivator for the mammalian TEFs.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human VGLL3

Key Reference: Maeda,T., (2002) J. Biol. Chem. 277 (50), 48889-48898

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: CDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGLQHQDKSKESPWY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transcription cofactor vestigial-like protein 3

Protein Size: 326

Purification: Affinity Purified

• Artikelnummer: AVIARP55341_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55341_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 389136
• Wirt: Rabbit