VPS28 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a protein involved in endosomal sorting of cell surface receptors via a multivesicular body/late endosome pathway. The encoded protein is one of the three subunits of the ESCRT-I complex (endosomal complexes required for transport) invol

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human VPS28

Key Reference: Hui,E.K., (2006) J. Virol. 80 (5), 2291-2308

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Vacuolar protein sorting-associated protein 28 homolog

Protein Size: 221

Purification: Affinity Purified

• Artikelnummer: AVIARP56850_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56850_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 51160
• Wirt: Rabbit