VPS29 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene belongs to a group of vacuolar protein sorting (VPS) genes that, when functionally impaired, disrupt the efficient delivery of vacuolar hydrolases. The protein encoded by this gene is a component of a large multimeric complex, termed the retrome

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human VPS29

Key Reference: Hierro,A., (2007) Nature 449 (7165), 1063-1067

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: LCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Vacuolar protein sorting-associated protein 29

Protein Size: 182

Purification: Affinity Purified

• Artikelnummer: AVIARP56858_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56858_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 51699
• Wirt: Rabbit