VTA1 Antibody - N-terminal region : Biotin

VTA1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56921_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: C6ORF55 encodes a protein involved in trafficking of the multivesicular body, an endosomal compartment involved in sorting membrane proteins for degradation in lysosomes (Ward et al., 2005 [PubMed 15644320]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human VTA1

Key Reference: Ward,D.M., (2005) J. Biol. Chem. 280 (11), 10548-10555

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: KKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Vacuolar protein sorting-associated protein VTA1 homolog

Protein Size: 307

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56921_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56921_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51534
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×