English
VTCN1 Antibody - N-terminal region : Biotin
VTCN1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP59079_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: This gene encodes a protein belonging to the B7 costimulatory protein family. Proteins in this family are present on the surface of antigen-presenting cells and interact with ligand bound to receptors on the surface of T cells. Studies have shown that high levels of the encoded protein has been correlated with tumor progression. A pseudogene of this gene is located on chromosome 20. Multiple transcript variants encoding different isoforms have been found for this gene.
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human VTCN1
Key Reference: N/A
Molecular Weight: 31kDa
Peptide Sequence: Synthetic peptide located within the following region: DIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIV
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: V-set domain-containing T-cell activation inhibitor 1
Protein Size: 282
Purification: Affinity purified
Description of Target: This gene encodes a protein belonging to the B7 costimulatory protein family. Proteins in this family are present on the surface of antigen-presenting cells and interact with ligand bound to receptors on the surface of T cells. Studies have shown that high levels of the encoded protein has been correlated with tumor progression. A pseudogene of this gene is located on chromosome 20. Multiple transcript variants encoding different isoforms have been found for this gene.
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human VTCN1
Key Reference: N/A
Molecular Weight: 31kDa
Peptide Sequence: Synthetic peptide located within the following region: DIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIV
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: V-set domain-containing T-cell activation inhibitor 1
Protein Size: 282
Purification: Affinity purified
| Artikelnummer | AVIARP59079_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP59079_P050-Biotin |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 79679 |
| Wirt | Rabbit |
| Konjugat | Conjugated, Biotin |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
