WDR21B Antibody - middle region : Biotin

WDR21B Antibody - middle region : Biotin
Artikelnummer
AVIARP54469_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The specific function of WDR21B is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WDR21B

Key Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: HEEEGIVVAVGQDCYTRIWSLHDAHLLRTIPSPYSASEDDIPSVAFASRL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DDB1- and CUL4-associated factor 4-like protein 1

Protein Size: 396

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54469_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54469_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 285429
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×