WDR51B Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: WDR51B contains 7 WD repeats. The function of the WDR51B protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human WDR51B

Key Reference: Higa,L.A., (2006) Nat. Cell Biol. 8 (11), 1277-1283

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: GNLLASASRDRTVRLWIPDKRGKFSEFKAHTAPVRSVDFSADGQFLATAS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: POC1 centriolar protein homolog B

Protein Size: 478

Purification: Affinity Purified

• Artikelnummer: AVIARP55620_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55620_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 282809
• Wirt: Rabbit