WDR5B Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This intronless gene encodes a protein containing several WD40 repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, including a trp-asp at the C-terminal end. The encoded protein may mediate protein-protein interactions.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human WDR5B

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: DVAWSSDSSRLVSASDDKTLKLWDVRSGKCLKTLKGHSNYVFCCNFNPPS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: WD repeat-containing protein 5B

Protein Size: 330

Purification: Affinity Purified

• Artikelnummer: AVIARP57325_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57325_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 54554
• Wirt: Rabbit