WDR77 Antibody - N-terminal region : FITC

WDR77 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58692_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: WDR77 is the non-catalytic component of the 20S PRMT5-containing methyltransferase complex, which modifies specific arginines to dimethylarginines in several spliceosomal Sm proteins. This modification targets Sm proteins to the survival of motor neurons (SMN) complex for assembly into small nuclear ribonucleoprotein core particles. WDR77 might play a role in transcription regulation. The 20S PRMT5-containing methyltransferase complex also methylates the Piwi proteins (PIWIL1, PIWIL2 and PIWIL4), methylation of Piwi proteins being required for the interaction with Tudor domain-containing proteins and subsequent localization to the meiotic nuage.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human WDR77

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: MRKETPPPLVPPAAREWNLPPNAPACMERQLEAARYRSDGALLLGASSLS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Methylosome protein 50

Protein Size: 342

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58692_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58692_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 79084
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×