WIPI1 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: WD40 repeat proteins are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions. Members of the WIPI subfamily of WD40 repeat proteins, such as WIPI1, have a 7-bladed propeller structure and contain a conserved motif for interaction with phospholipids.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human WIPI1

Key Reference: N/A

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: LDPQDGGECVLIKTHSLLGSGTTEENKENDLRPSLPQSYAATVARPSASS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: WD repeat domain phosphoinositide-interacting protein 1

Protein Size: 446

Purification: Affinity purified

• Artikelnummer: AVIARP58980_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58980_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55062
• Wirt: Rabbit