WIPI1 Antibody - C-terminal region : FITC

WIPI1 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP58980_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: WD40 repeat proteins are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions. Members of the WIPI subfamily of WD40 repeat proteins, such as WIPI1, have a 7-bladed propeller structure and contain a conserved motif for interaction with phospholipids.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human WIPI1

Key Reference: N/A

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: LDPQDGGECVLIKTHSLLGSGTTEENKENDLRPSLPQSYAATVARPSASS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: WD repeat domain phosphoinositide-interacting protein 1

Protein Size: 446

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP58980_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58980_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55062
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×