Wnt3a Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: Wnt3a is a ligand for members of the frizzled family of seven transmembrane receptors. Wnt-3 and Wnt-3a play distinct roles in cell-cell signaling during morphogenesis of the developing neural tube.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein Wnt-3a

Protein Size: 352

Purification: Affinity Purified

• Artikelnummer: AVIARP58819_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58819_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 22416
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin