WNT3A Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryog

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human WNT3A

Key Reference: Chiquet,B.T., (er) Hum. Mol. Genet. (2008) In press

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein Wnt-3a

Protein Size: 352

Purification: Affinity Purified

• Artikelnummer: AVIARP58818_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58818_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 89780
• Wirt: Rabbit
• Konjugat: Conjugated, HRP