Wnt8b Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: Wnt8b is a ligand for members of the frizzled family of seven transmembrane receptors. It may play an important role in the development and differentiation of certain forebrain structures, notably the hippocampus.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Wnt8b

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: SISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein Wnt-8b

Protein Size: 350

Purification: Affinity Purified

• Artikelnummer: AVIARP58100_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58100_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 22423
• Wirt: Rabbit