WNT8B Antibody - N-terminal region : FITC

WNT8B Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58099_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The WNT family consists of sereval secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT8B is a protein which shows 95%, 86% and 71% amino acid identity to the mouse, zebrafish and Xenopus Wnt8B proteins, respectively. The expression patterns of the human and mouse genes appear identical and are restricted to the developing brain. The chromosomal location of this gene to 10q24 suggests it as a candidate gene for partial epilepsy.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human WNT8B

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: QLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein Wnt-8b

Protein Size: 351

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58099_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58099_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 7479
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×