YKL-39 antibody

Quote the promo code SZANTIBODY when ordering to receive a 10% discount on this antibody, from October 1st to December 31st 2024. No additional discounts during the promo.

Calculated MW: 44

Form: Liquid

Buffer (with preservative): PBS, 2% sucrose, 0.09% sodium azide.

Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)

Background: The protein encoded by this gene is similar to bacterial chitinases but lacks chitinase activity. The encoded protein is secreted and is involved in cartilage biogenesis. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012]

Uniprot ID: Q15782

Antigen Species: Human

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CHI3L2 protein: KLAKDLDFINLLSFDFHGSWEKPLITGHNSPLSKGWQDRGPSSYYNVEYA

Purification: Purified by affinity chromatography

Conjugation: Unconjugated

Full Name: chitinase 3 like 2

• Artikelnummer: GTX04608-100
• Hersteller: GeneTex
• Hersteller Artikelnummer: GTX04608-100
• Verpackungseinheit: 100 μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Isotyp: IgG
• Human Gene ID: 1117
• Wirt: Rabbit
• Konjugat: Unconjugated