YTHDF3 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: YTHDF3 contains 1 YTH domain. The functions of YTHDF3 remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human YTHDF3

Key Reference: Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: GEAAWSTAGDQPMPYLTTYGQMSNGEHHYIPDGVFSQPGALGNTPPFLGQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: YTH domain family protein 3

Protein Size: 585

Purification: Affinity Purified

• Artikelnummer: AVIARP55529_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55529_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 253943
• Wirt: Rabbit