English
ZCCHC13 Antibody - middle region : FITC
ZCCHC13 Antibody - middle region : FITC
Artikelnummer
AVIARP55945_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate
Description of Target: The specific function of this protein remains unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZCCHC13
Key Reference: Lim,J., (2006) Cell 125 (4), 801-814
Molecular Weight: 18kDa
Peptide Sequence: Synthetic peptide located within the following region: GKLGHIQKDCAQVKCYRCGEIGHVAINCSKARPGQLLPLRQIPTSSQGMS
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Zinc finger CCHC domain-containing protein 13
Protein Size: 166
Purification: Affinity Purified
Description of Target: The specific function of this protein remains unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZCCHC13
Key Reference: Lim,J., (2006) Cell 125 (4), 801-814
Molecular Weight: 18kDa
Peptide Sequence: Synthetic peptide located within the following region: GKLGHIQKDCAQVKCYRCGEIGHVAINCSKARPGQLLPLRQIPTSSQGMS
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Zinc finger CCHC domain-containing protein 13
Protein Size: 166
Purification: Affinity Purified
| Artikelnummer | AVIARP55945_P050FITC |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP55945_P050-FITC |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 389874 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
